PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007720P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bHLH
Protein Properties Length: 228aa    MW: 25351.5 Da    PI: 10.9577
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007720P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH35.71.5e-114797454
                    HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
             HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                    +h  +E++RR+ri   +++Lr +lP++sk+++ Kl Ka +L ++++ +k+L
  MELO3C007720P1 47 KHRLAEQNRRNRISGQYATLRAILPSLSKTDKSKLKKAFVLSETIRGVKEL 97
                    79************************99*****************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.57E-1038107IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.3734397IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000838.60E-746102No hitNo description
PfamPF000104.5E-94697IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.4E-1047101IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.5E-649103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd048730.00324140200No hitNo description
Gene3DG3DSA:3.30.70.2601.6E-4140196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MQSIPSYPTS GTMHQIYPQA QAPMINPYSC PISSFPRKEP KLNAAVKHRL AEQNRRNRIS  60
GQYATLRAIL PSLSKTDKSK LKKAFVLSET IRGVKELKKL VSEKRVANRE FRDCGIPSGA  120
DRLTLEQCNG GEGMVKAVMS CEDRQDIMAE LAKALKTMKV KLVRAEMVTV GGRNKFSLWI  180
QGPKEGHGGI KRVLEAVMKR PSWIARKPRN VWQSRASTDN NFNGVAS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440558.11e-170PREDICTED: transcription factor bHLH131-like
TrEMBLA0A0A0KG671e-153A0A0A0KG67_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126113032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38070.17e-25bHLH family protein